PDB entry 4hur

View 4hur on RCSB PDB site
Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus in complex with acetyl coenzyme A
Class: transferase
Keywords: STRUCTURAL GENOMICS, ANTIBIOTIC RESISTANCE, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES (CSGID), NIAID, NATIONAL INSTITUTE OF ALLERGY AND INFECTIOUS DISEASES, XENOBIOTIC ACYLTRANSFERASE (XAT) FAMILY, HEXAPEPTIDE REPEAT ACYLTRANSFERASE, streptogramin group A antibiotic acetyltransferase, STREPTOGRAMIN GROUP A ANTIBIOTICS, STREPTOGRAMIN A, VIRGINIAMYCIN M1, DALFOPRISTIN, ACETYL COENZYME A, COENZYME A, INTRACELLULAR, TRANSFERASE
Deposited on 2012-11-03, released 2012-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.168
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hura_
  • Chain 'B':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hurb_
  • Chain 'C':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hurc_
  • Heterogens: ACO, SO4, EDO, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hurA (A:)
    gmnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhy
    evigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdi
    eigndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvie
    ewlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hurA (A:)
    hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
    iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
    igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
    wnldmkiinenlpfiingdiemlkrkrklld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hurB (B:)
    gmnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhy
    evigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdi
    eigndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvie
    ewlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hurB (B:)
    hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
    iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
    igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
    wnldmkiinenlpfiingdiemlkrkrklld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hurC (C:)
    gmnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhy
    evigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdi
    eigndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvie
    ewlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hurC (C:)
    dhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkl