PDB entry 4hu7

View 4hu7 on RCSB PDB site
Description: E. coli thioredoxin variant with Pro76 as single proline residue
Class: oxidoreductase
Keywords: cisproline, Thioredoxin fold, protein disulfide oxidoreductase activity, oxidoreductase
Deposited on 2012-11-02, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-End)
      • engineered mutation (33)
      • engineered mutation (39)
      • engineered mutation (63)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4hu7a_
  • Chain 'B':
    Compound: Thioredoxin-1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered mutation (33)
      • engineered mutation (39)
      • engineered mutation (63)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4hu7b_
  • Heterogens: CU, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hu7A (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklni
    dqnagtaakygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hu7A (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklni
    dqnagtaakygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hu7B (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklni
    dqnagtaakygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hu7B (B:)
    iihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklnidqn
    agtaakygirgiptlllfkngevaatkvgalskgqlkefldanl