PDB entry 4hu1

View 4hu1 on RCSB PDB site
Description: Crystal structure of human carbonic anhydrase isozyme XIII with the inhibitor.
Class: lyase/lyase inhibitor
Keywords: drug design, carbonic anhydrase, benzenesulfonamide,metal-binding, lyase-lyase inhibitor complex, carbonate dehydratase activity, carbon-oxygen lyase activity
Deposited on 2012-11-02, released 2013-04-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4hu1a_
  • Chain 'B':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4hu1b_
  • Heterogens: ZN, V13, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hu1A (A:)
    mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
    isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
    hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
    fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
    aflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hu1A (A:)
    lswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisns
    ghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvh
    wnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdll
    sllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflv
    snhrppqplkgrkvrasfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hu1B (B:)
    mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
    isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
    hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
    fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
    aflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hu1B (B:)
    rlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisn
    sghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvv
    hwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdl
    lsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaafl
    vsnhrppqplkgrkvrasfh