PDB entry 4hr3

View 4hr3 on RCSB PDB site
Description: Structure of a putative acyl-CoA dehydrogenase from Mycobacterium abscessus
Class: oxidoreductase
Keywords: SSGCID, Seattle Structural Genomics Center for Infectious Disease, NIAID, National Institute of Allergy and Infectious Diseases, dehydrogenase, OXIDOREDUCTASE
Deposited on 2012-10-26, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acyl-CoA dehydrogenase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_0255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hr3a1, d4hr3a2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hr3A (A:)
    gpgsmdfapsaraaeliaavrefidaevmpveravlahhdellgaragttaelwhvppel
    dslkakaraaglwnlflpdpelggglsnseyaplaeqmgrslfaptvfncnapdsgnmev
    lhrygsqeqkevwlepllegdirsafcmtepdvassdatnmaatavvegdevvingrkww
    stgvghpdckviifmgltdpnahryarhsmvlvpmdtpgitvermlptmgfydepgghgv
    vsfdnvrlpadafiagpgkgfeiaqgrlgpgrvhhamrliglaevalehacrrgldrtaf
    gkplvnlggnreriadariainqtrllvlhaawlldtvgimgalsavseikvaapnmaqq
    vidmaiqihgggglsndfplaaawvnaralrladgpdevhrgvvarielakyand
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hr3A (A:)
    fapsaraaeliaavrefidaevmpveravlahhdellgaragttaelwhvppeldslkak
    araaglwnlflpdpelggglsnseyaplaeqmgrslfaptvfncnapdsgnmevlhrygs
    qeqkevwlepllegdirsafcmtepdvassdatnmaatavvegdevvingrkwwstgvgh
    pdckviifmgltdpnahryarhsmvlvpmdtpgitvermlptmgfydepgghgvvsfdnv
    rlpadafiagpgkgfeiaqgrlgpgrvhhamrliglaevalehacrrgldrtafgkplvn
    lggnreriadariainqtrllvlhaawlldtvgimgalsavseikvaapnmaqqvidmai
    qihgggglsndfplaaawvnaralrladgpdevhrgvvarielakya