PDB entry 4hqq

View 4hqq on RCSB PDB site
Description: Crystal structure of RV144-elicited antibody CH58
Class: Immune System
Keywords: Immunoglobulin, Immune System
Deposited on 2012-10-25, released 2013-02-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CH58 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HQQ (0-End)
  • Chain 'L':
    Compound: CH58 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HQQ (0-End)
    Domains in SCOPe 2.04: d4hqql1, d4hqql2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hqqL (L:)
    nfmltqphsvsespgktvtisctrssgsvasdyvqwyqqrpgsapttvvyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydnsswvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hqqL (L:)
    nfmltqphsvsespgktvtisctrssgsvasdyvqwyqqrpgsapttvvyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydnsswvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvap