PDB entry 4hpn

View 4hpn on RCSB PDB site
Description: Crystal structure of a proposed galactarolactone cycloisomerase from Agrobacterium Tumefaciens, target EFI-500704, with bound Ca, ordered loops
Class: Isomerase
Keywords: ENOLASE, enzyme function initiative, EFI, Structural Genomics, Isomerase
Deposited on 2012-10-24, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu3139
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hpna1, d4hpna2
  • Heterogens: CA, IMD, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hpnA (A:)
    mkitavrthllehrldtpfesasmrfdrrahvlveiecddgtvgwgeclgparpnaavvq
    aysgwligqdprqtekiwavlynalrdqgqrglsltalsgidialwdikgkhygasisml
    lggrwresvrayatgsfkrdnvdrvsdnasemaerraegfhackikigfgveedlrviaa
    vreaigpdmrlmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpi
    pvaggetwhgrygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgt
    gvqiaaalqfmaamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpg
    lgieinrdaltefrmpdp