PDB entry 4hoy

View 4hoy on RCSB PDB site
Description: Crystal structure of Peptidyl- tRNA Hydrolase from Acinetobacter baumannii at 1.78 A resolution
Class: hydrolase
Keywords: PEPTIDYL-TRNA HYDROLASE, enzyme, Molecular Conformation, Inhibition, HYDROLASE
Deposited on 2012-10-23, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.17
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: HMPREF0010_01329, pth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4hoya_
  • Heterogens: GOL, EDO, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hoyA (A:)
    msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
    rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
    ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
    pqamnqinaykpa