PDB entry 4hnr

View 4hnr on RCSB PDB site
Description: High resolution structure of Chemotaxis response regulator CheY4 of Vibrio cholerae
Class: signaling protein
Keywords: Rossmann fold, response regulator protein, kinase, SIGNALING PROTEIN
Deposited on 2012-10-21, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_A1096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hnra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hnrA (A:)
    tmakvlavddsisirqmvshtlqdagyevetaadgrealakaqkarfdviisdvnmpvmt
    gfefvkavrmqsqykftpilmlttetspekkqegkavgatgwlvkpfnpetllktlqrvl