PDB entry 4hnl

View 4hnl on RCSB PDB site
Description: Crystal structure of ENOLASE EGBG_01401 (TARGET EFI-502226) from Enterococcus gallinarum EG2
Class: isomerase
Keywords: dehydratase, magnesium binding, enzyme function initiative, isomerase
Deposited on 2012-10-19, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.124
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Enterococcus gallinarum EG2 [TaxId:565653]
    Gene: EGBG_01401
    Database cross-references and differences (RAF-indexed):
    • Uniprot C8ZZN2 (22-420)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4hnla1, d4hnla2, d4hnla3
  • Heterogens: MG, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hnlA (A:)
    mhhhhhhssgvdlgtenlyfqsmtptiitdvksfaikpdrhnlvvvkvetnkgisglgcs
    tfqfrplavktvvdeylrpllmgrdaneiediwqvmnvnsywrngpitnnaisgidmalw
    dikgqladmplyqllggkartaipaythavadnlddlyheidrflaagyryircqlgfyg
    gnpsqlqtpeepisgsyfdqtdymettlkmfaaikekygnqfqmlhdvherlhpnqaiqf
    akaaepyqlffledilppdqshwltqlrsqsatpiatgelfnnpmewqelvknrqidfmr
    ahvsqiggitpalklahfcdamgvriawhtpsdispvglavnthlnihlhnaaiqetiel
    pantqsvfvgspqpkggffypmeksgigitfdeeaaadfpvvyrphewtqsrtpdgtlit
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hnlA (A:)
    qsmtptiitdvksfaikpdrhnlvvvkvetnkgisglgcstfqfrplavktvvdeylrpl
    lmgrdaneiediwqvmnvnsywrngpitnnaisgidmalwdikgqladmplyqllggkar
    taipaythavadnlddlyheidrflaagyryircqlgfyggnpsqlqtpeepisgsyfdq
    tdymettlkmfaaikekygnqfqmlhdvherlhpnqaiqfakaaepyqlffledilppdq
    shwltqlrsqsatpiatgelfnnpmewqelvknrqidfmrahvsqiggitpalklahfcd
    amgvriawhtpsdispvglavnthlnihlhnaaiqetielpantqsvfvgspqpkggffy
    pmeksgigitfdeeaaadfpvvyrphewtqsrtpdgtlitp