PDB entry 4hnc

View 4hnc on RCSB PDB site
Description: P. putida C92S/K166C/C264S mandelate racemase co-crystallized with benzilic acid
Class: isomerase
Keywords: Enolase superfamily enzyme, ISOMERASE
Deposited on 2012-10-19, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase
    Species: Pseudomonas putida [TaxId:303]
    Gene: mdlA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11444 (Start-382)
      • engineered mutation (115)
      • engineered mutation (189)
      • engineered mutation (287)
    Domains in SCOPe 2.07: d4hnca1, d4hnca2
  • Chain 'B':
    Compound: mandelate racemase
    Species: Pseudomonas putida [TaxId:303]
    Gene: mdlA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11444 (Start-382)
      • engineered mutation (115)
      • engineered mutation (189)
      • engineered mutation (287)
    Domains in SCOPe 2.07: d4hncb1, d4hncb2
  • Heterogens: MG, 0UT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hncA (A:)
    maswshpqfekgalevlfqgpgyhmsevlitglrtravnvplaypvhtavgtvgtaplvl
    idlatsagvvghsylfaytpvalkslkqllddmaamivneplapvsleamlakrfslagy
    tglirmaaagidmaawdalgkvhetplvkllganarpvqaydshsldgvklateravtaa
    elgfravktcigypaldqdlavvrsirqavgddfgimvdynqsldvpaaikrsqalqqeg
    vtwieeptlqhdyeghqriqsklnvpvqmgenwlgpeemfkalsigasrlampdamkigg
    vtgwirasalaqqfgipmsshlfqeisahllaatptahwlerldlagsvieptltfeggn
    avipdlpgvgiiwrekeigkylv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hncA (A:)
    evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
    kqllddmaamivneplapvsleamlakrfslagytglirmaaagidmaawdalgkvhetp
    lvkllganarpvqaydshsldgvklateravtaaelgfravktcigypaldqdlavvrsi
    rqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvp
    vqmgenwlgpeemfkalsigasrlampdamkiggvtgwirasalaqqfgipmsshlfqei
    sahllaatptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hncB (B:)
    maswshpqfekgalevlfqgpgyhmsevlitglrtravnvplaypvhtavgtvgtaplvl
    idlatsagvvghsylfaytpvalkslkqllddmaamivneplapvsleamlakrfslagy
    tglirmaaagidmaawdalgkvhetplvkllganarpvqaydshsldgvklateravtaa
    elgfravktcigypaldqdlavvrsirqavgddfgimvdynqsldvpaaikrsqalqqeg
    vtwieeptlqhdyeghqriqsklnvpvqmgenwlgpeemfkalsigasrlampdamkigg
    vtgwirasalaqqfgipmsshlfqeisahllaatptahwlerldlagsvieptltfeggn
    avipdlpgvgiiwrekeigkylv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hncB (B:)
    evlitglrtravnvplaypvhgtaplvlidlatsagvvghsylfaytpvalkslkqlldd
    maamivneplapvsleamlakrfslagytglirmaaagidmaawdalgkvhetplvkllg
    anarpvqaydshsldgvklateravtaaelgfravktcigypaldqdlavvrsirqavgd
    dfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgen
    wlgpeemfkalsigasrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahlla
    atptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv