PDB entry 4hn8

View 4hn8 on RCSB PDB site
Description: Crystal structure of a putative D-glucarate dehydratase from Pseudomonas mendocina ymp
Class: lyase
Keywords: structural genomics, PSI-Biology, Protein Structure Initiative, New York Structural Genomics Research Consortium, NYSGRC, LYASE
Deposited on 2012-10-19, released 2012-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8a1, d4hn8a2
  • Chain 'B':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8b1, d4hn8b2
  • Chain 'C':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8c1, d4hn8c2
  • Chain 'D':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8d1, d4hn8d2
  • Chain 'E':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8e1
  • Chain 'F':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8f1
  • Chain 'G':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8g1
  • Chain 'H':
    Compound: d-glucarate dehydratase
    Species: Pseudomonas mendocina [TaxId:399739]
    Gene: Pmen_1214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hn8h1, d4hn8h2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hn8A (A:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8A (A:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaialrldnvitaveaalldllgqhlevpvaellgsg
    qqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaarary
    gfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlaya
    edpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtm
    qgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerlt
    replrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhp
    krpslgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hn8B (B:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8B (B:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaiarldnvitaveaalldllgqhlevpvaellgsgq
    qrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaararyg
    fadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlayae
    dpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtmq
    gavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerltr
    eplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhpk
    rpslgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hn8C (C:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8C (C:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaialrldnvitaveaalldllgqhlevpvaellgsg
    qqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaarary
    gfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlaya
    edpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtm
    qgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerlt
    replrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhp
    krpslgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hn8D (D:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8D (D:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaialrldnvitaveaalldllgqhlevpvaellgsg
    qqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaarary
    gfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlaya
    edpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtm
    qgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerlt
    replrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhp
    krpslgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hn8E (E:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8E (E:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaiarldnvitaveaalldllgqhlevpvaellgsgq
    qrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaararyg
    fadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlayae
    dpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtmq
    gavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerltr
    eplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhpk
    rpslgr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4hn8F (F:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8F (F:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaiarldnvitaveaalldllgqhlevpvaellgsgq
    qrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaararyg
    fadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlayae
    dpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtmq
    gavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerltr
    eplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhpk
    rpslgr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hn8G (G:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8G (G:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaiarldnvitaveaalldllgqhlevpvaellgsgq
    qrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaararyg
    fadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlayae
    dpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtmq
    gavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerltr
    eplrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhpk
    rpslgr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hn8H (H:)
    mslhqaspsstprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevp
    ggegirqalercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaq
    pheinlrldnvitaveaalldllgqhlevpvaellgsgqqrqrvpmlaylfyigerqrad
    lpylagkgsaddwyhlrhqaaltpdaiarlaeaararygfadfklkggvmrgaeemeair
    aikarfpdarvtldpngawsldeaialckgqghvlayaedpcgpengysgrevmaefkra
    tgiptatnmvatdwrqmghslrleavdipladphfwtmqgavrlgqvceefgltwgshsn
    nhfdislamfthaaaavpgritaidthwiwqegeerltreplrivggqvqvpdkpglgie
    pdmqrimaahelykkvasgarddamamqylvpgwqyhpkrpslgreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hn8H (H:)
    stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
    ercrervigqsvgrynrvlndlrqaialrldnvitaveaalldllgqhlevpvaellgsg
    qqrqrvpmlaylfyigerqradlpylagkgsaddwyhlrhqaaltpdaiarlaeaarary
    gfadfklkggvmrgaeemeairaikarfpdarvtldpngawsldeaialckgqghvlaya
    edpcgpengysgrevmaefkratgiptatnmvatdwrqmghslrleavdipladphfwtm
    qgavrlgqvceefgltwgshsnnhfdislamfthaaaavpgritaidthwiwqegeerlt
    replrivggqvqvpdkpglgiepdmqrimaahelykkvasgarddamamqylvpgwqyhp
    krpslgr