PDB entry 4hkz

View 4hkz on RCSB PDB site
Description: Trastuzumab Fab complexed with Protein L and Protein A fragments
Class: immune system
Keywords: monoclonal antibody, immune system, cancer therapeutic
Deposited on 2012-10-15, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trastuzumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HKZ (0-212)
    Domains in SCOPe 2.07: d4hkza1, d4hkza2
  • Chain 'B':
    Compound: Trastuzumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HKZ (0-220)
  • Chain 'E':
    Compound: Protein L fragment
    Species: Finegoldia magna [TaxId:1260]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HKZ (0-62)
    Domains in SCOPe 2.07: d4hkze1, d4hkze2
  • Chain 'H':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: spa, SAV0111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A015 (3-53)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4hkzh1, d4hkzh2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hkzA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hkzE (E:)
    sevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnik
    fag
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hkzH (H:)
    gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa