PDB entry 4hkx

View 4hkx on RCSB PDB site
Description: Influenza hemagglutinin in complex with CH67 Fab
Class: viral protein/immune system
Keywords: Fab fragment, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-10-15, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CH67 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HKX (0-End)
  • Chain 'B':
    Compound: CH67 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HKX (0-End)
    Domains in SCOPe 2.07: d4hkxb1, d4hkxb2
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:464623]
    Gene: HA1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hkxB (B:)
    qsaltqppsvsvapgqtatitcggnnigrkrvdwfqqkpgqapvlvvyedsdrpsgiper
    fsdsnsgttatltisrveagdeadyycqvwdsdsdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hkxB (B:)
    qsaltqppsvsvapgqtatitcggnnigrkrvdwfqqkpgqapvlvvyerfsdsnsgtta
    tltisrveagdeadyycqvwdsdsdhvvfgggtkltvlgqpkaapsvtlfppsseelqan
    katlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeqwksh
    rsyscqvthegstvektvapt
    

  • Chain 'E':
    No sequence available.