PDB entry 4hk3

View 4hk3 on RCSB PDB site
Description: I2 Fab (unbound) from CH65-CH67 Lineage
Class: immune system
Keywords: Fab fragment, IMMUNE SYSTEM
Deposited on 2012-10-14, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'J':
    Compound: I2 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HK3 (0-End)
  • Chain 'N':
    Compound: I2 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HK3 (0-End)
    Domains in SCOPe 2.07: d4hk3n1, d4hk3n2

PDB Chain Sequences:

  • Chain 'J':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4hk3N (N:)
    qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk3N (N:)
    qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap