PDB entry 4hk0

View 4hk0 on RCSB PDB site
Description: UCA Fab (unbound) from CH65-CH67 Lineage
Class: immune system
Keywords: Fab fragment, IMMUNE SYSTEM
Deposited on 2012-10-14, released 2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UCA heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HK0 (0-End)
  • Chain 'B':
    Compound: UCA light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HK0 (0-End)
    Domains in SCOPe 2.04: d4hk0b1, d4hk0b2
  • Chain 'C':
    Compound: UCA heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HK0 (0-End)
  • Chain 'D':
    Compound: UCA light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HK0 (0-End)
    Domains in SCOPe 2.04: d4hk0d1, d4hk0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hk0B (B:)
    qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk0B (B:)
    qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hk0D (D:)
    qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hk0D (D:)
    qsvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap