PDB entry 4hjx

View 4hjx on RCSB PDB site
Description: Crystal structure of F2YRS complexed with F2Y
Class: ligase
Keywords: aminoacyl-tRNA synthetase, ligase
Deposited on 2012-10-14, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-tRNA ligase
    Species: Methanococcus Jannaschii DSM 2661 [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • enigneered mutation (31)
      • enigneered mutation (64)
      • enigneered mutation (69)
      • enigneered mutation (107-108)
      • enigneered mutation (157)
      • enigneered mutation (161)
    Domains in SCOPe 2.07: d4hjxa_
  • Chain 'B':
    Compound: Tyrosine-tRNA ligase
    Species: Methanococcus Jannaschii DSM 2661 [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • enigneered mutation (31)
      • enigneered mutation (64)
      • enigneered mutation (69)
      • enigneered mutation (107-108)
      • enigneered mutation (157)
      • enigneered mutation (161)
    Domains in SCOPe 2.07: d4hjxb_
  • Heterogens: F2Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hjxA (A:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjxA (A:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hjxB (B:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjxB (B:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl