PDB entry 4hjr

View 4hjr on RCSB PDB site
Description: Crystal structure of F2YRS
Class: ligase
Keywords: aminoacyl-tRNA synthetase, f2y, ligase
Deposited on 2012-10-13, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-tRNA ligase
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (69)
      • engineered mutation (107-108)
      • engineered mutation (157)
      • engineered mutation (161)
      • expression tag (306-308)
    Domains in SCOPe 2.07: d4hjra1, d4hjra2
  • Chain 'B':
    Compound: Tyrosine-tRNA ligase
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (69)
      • engineered mutation (107-108)
      • engineered mutation (157)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d4hjrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hjrA (A:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjrA (A:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrlleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hjrB (B:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjrB (B:)
    mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
    diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrl