PDB entry 4hjg

View 4hjg on RCSB PDB site
Description: Meditope-enabled trastuzumab
Class: immune system
Keywords: monoclonal antibody, immune system, cancer therapeutic
Deposited on 2012-10-12, released 2013-10-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trastuzumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HJG (0-213)
    Domains in SCOPe 2.04: d4hjga1, d4hjga2
  • Chain 'B':
    Compound: Trastuzumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HJG (0-End)
  • Chain 'E':
    Compound: Protein L fragment
    Species: Finegoldia magna [TaxId:1260]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HJG (Start-64)
    Domains in SCOPe 2.04: d4hjge_
  • Chain 'H':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: spa, SAV0111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A015 (4-54)
      • expression tag (1-3)
    Domains in SCOPe 2.04: d4hjgh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hjgA (A:)
    diqmtqspillsasvgdrvtitcrasqdvntavawyqqrtngsprlliysasflysgvps
    rfsgsrsgtdftltisslqpediadyycqqhyttpptfgagtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hjgE (E:)
    sgsevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmn
    ikfag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjgE (E:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikf
    ag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hjgH (H:)
    sgsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hjgH (H:)
    gsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa