PDB entry 4hhv

View 4hhv on RCSB PDB site
Description: Crystal structure of ceramide transfer protein pleckstrin homology domain
Class: lipid transport
Keywords: Pleckstrin homology domain fold, Binds to phosphatidylinositol 4-phosphate, LIPID TRANSPORT
Deposited on 2012-10-10, released 2013-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen type IV alpha-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CERT, COL4A3BP, STARD11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5P4 (3-104)
      • expression tag (2)
    Domains in SCOPe 2.05: d4hhva_
  • Chain 'B':
    Compound: Collagen type IV alpha-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CERT, COL4A3BP, STARD11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4hhvb_
  • Heterogens: SO4, GOL, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hhvA (A:)
    gefsgppvercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavi
    tphdfdecrfdisvndsvwylraqdpdhrqqwidaieqhktesgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhvA (A:)
    fsgppvercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavitp
    hdfdecrfdisvndsvwylraqdpdhrqqwidaieqhktesgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hhvB (B:)
    gefsgppvercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavi
    tphdfdecrfdisvndsvwylraqdpdhrqqwidaieqhktesgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hhvB (B:)
    sgppvercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavitph
    dfdecrfdisvndsvwylraqdpdhrqqwidaieqhktesg