PDB entry 4hh9

View 4hh9 on RCSB PDB site
Description: Anti-Human Cytomegalovirus (HCMV) Fab KE5
Class: immune system
Keywords: Fab, Antibody, IMMUNE SYSTEM
Deposited on 2012-10-09, released 2013-10-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab KE5, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HH9 (0-214)
    Domains in SCOPe 2.04: d4hh9a1, d4hh9a2
  • Chain 'B':
    Compound: Fab KE5, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HH9 (0-End)
  • Chain 'C':
    Compound: Fab KE5, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HH9 (0-214)
    Domains in SCOPe 2.04: d4hh9c1, d4hh9c2
  • Chain 'D':
    Compound: Fab KE5, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HH9 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hh9A (A:)
    evvltqspatlslspgeratiscrasqsvggyltwyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisglepedfaiyycqqrgnwppitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hh9A (A:)
    evvltqspatlslspgeratiscrasqsvggyltwyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisglepedfaiyycqqrgnwppitfgqgtrleikrtvaapsvfifp
    psdeqlkgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hh9C (C:)
    evvltqspatlslspgeratiscrasqsvggyltwyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisglepedfaiyycqqrgnwppitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hh9C (C:)
    evvltqspatlslspgeratiscrasqsvggyltwyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisglepedfaiyycqqrgnwppitfgqgtrleikrtvaapsvfifp
    psdeqlkgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    No sequence available.