PDB entry 4hfw

View 4hfw on RCSB PDB site
Description: Anti Rotavirus Antibody
Class: immune system
Keywords: Ig fold, Immune Response, Rotavirus VP6 protein, IMMUNE SYSTEM
Deposited on 2012-10-05, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-26 Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HFW
    Domains in SCOPe 2.07: d4hfwa1, d4hfwa2
  • Chain 'B':
    Compound: 6-26 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HFW (0-End)
  • Chain 'H':
    Compound: 6-26 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HFW (0-End)
  • Chain 'L':
    Compound: 6-26 Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HFW (0-End)
    Domains in SCOPe 2.07: d4hfwl1, d4hfwl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hfwA (A:)
    dirltqspsslsasvgdrvtitcrasqsisnylnwyqkkpgqapklliyaatslqsgvps
    rfsgsgsgtdftltissvqpedfatyycqktlrtwtfgqgtkveikrtaaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hfwA (A:)
    irltqspsslsasvgdrvtitcrasqsisnylnwyqkkpgqapklliyaatslqsgvpsr
    fsgsgsgtdftltissvqpedfatyycqktlrtwtfgqgtkveikrtaaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hfwL (L:)
    dirltqspsslsasvgdrvtitcrasqsisnylnwyqkkpgqapklliyaatslqsgvps
    rfsgsgsgtdftltissvqpedfatyycqktlrtwtfgqgtkveikrtaaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hfwL (L:)
    dirltqspsslsasvgdrvtitcrasqsisnylnwyqkkpgqapklliyaatslqsgvps
    rfsgsgsgtdftltissvqpedfatyycqktlrtwtfgqgtkveikrtaaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge