PDB entry 4hfu

View 4hfu on RCSB PDB site
Description: Crystal structure of Fab 8M2 in complex with a H2N2 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: VIRAL PROTEIN/IMMUNE SYSTEM, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-10-05, released 2013-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.195
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:382813]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67085 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d4hfua_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:382813]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4hfub_
  • Chain 'H':
    Compound: Fab 8M2 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HFU
  • Chain 'L':
    Compound: Fab 8M2 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HFU (0-End)
    Domains in SCOPe 2.04: d4hful1, d4hful2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hfuA (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkyllssvkhfekvkilp
    kdrwtqhtttggsracavsgnpsffrnmvwltkkgsdypvakgsynntsgeqmliiwgvh
    hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdti
    nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
    gecpryvkseklvlatglrnvpqiesr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hfuA (A:)
    pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
    gwllgnpecdrllsvpewsyimekenprlcypgsfndyeelkyllssvkhfekvkilpkd
    rwtqhtttggsracavsgnpsffrnmvwltkkgsdypvakgsynntsgeqmliiwgvhhp
    ndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinf
    estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
    cpryvkseklvlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hfuB (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
    tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrneik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hfuB (B:)
    glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
    tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hfuL (L:)
    diqltqspaslsvspgeratlscrasqsvagnlawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltitslqsedfavyycqqynnwppwtfgqgtkvdikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hfuL (L:)
    diqltqspaslsvspgeratlscrasqsvagnlawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltitslqsedfavyycqqynnwppwtfgqgtkvdikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg