PDB entry 4heq

View 4heq on RCSB PDB site
Description: The crystal structure of flavodoxin from Desulfovibrio gigas
Class: electron transport
Keywords: Electron Transfer, cytoplasma, ELECTRON TRANSPORT
Deposited on 2012-10-04, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.181
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4heqa_
  • Chain 'B':
    Compound: flavodoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4heqb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4heqA (A:)
    mpkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstw
    gddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlv
    asslkidgepdsaevldwarevlarv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4heqA (A:)
    pkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstwg
    ddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlva
    sslkidgepdsaevldwarevlarv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4heqB (B:)
    mpkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstw
    gddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlv
    asslkidgepdsaevldwarevlarv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4heqB (B:)
    pkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstwg
    ddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlva
    sslkidgepdsaevldwarevlarv