PDB entry 4hep

View 4hep on RCSB PDB site
Description: Complex of lactococcal phage TP901-1 with a llama vHH (vHH17) binder (nanobody)
Class: viral protein
Keywords: Alpha-beta, phage receptor binding protein, llama glama vHH domain, viral protein, CELL ADHESION-IMMUNE SYSTEM complex
Deposited on 2012-10-04, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hepa1, d4hepa2
  • Chain 'G':
    Compound: vHH17 domain
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4HEP (Start-130)
    Domains in SCOPe 2.07: d4hepg_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hepA (A:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hepA (A:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hepG (G:)
    dvqlvesggglvqpggslrlsceasgfsfddyaigwfrqapgkeregvsyismsdgrtyv
    adsvtgrftissdnakntvylqmnslkledtavyycaagrfvtfgsawsfvgggpygidy
    wgkgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hepG (G:)
    vqlvesggglvqpggslrlsceasgfsfddyaigwfrqapgkeregvsyismsdgrtyva
    dsvtgrftissdnakntvylqmnslkledtavyycaagrfvtfgsawsfvgggpygidyw
    gkgtlvtvss