PDB entry 4hdo

View 4hdo on RCSB PDB site
Description: Crystal structure of the binary Complex of KRIT1 bound to the Rap1 GTPase
Class: signaling protein
Keywords: RA binding motif, PTB fold, GTPase, GTP, Rap effector, Rap1, HEG1, Cell-cell junctions, nucleus, SIGNALING PROTEIN
Deposited on 2012-10-02, released 2013-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.213
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Krev interaction trapped protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KRIT1, CCM1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4hdob_
  • Heterogens: GOL, MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hdoB (B:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hdoB (B:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    temrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdleder
    vvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr