PDB entry 4hdi

View 4hdi on RCSB PDB site
Description: Crystal Structure of 3E5 IgG3 FAB from mus musculus
Class: immune system
Keywords: IgG, FAB, IMMUNE SYSTEM
Deposited on 2012-10-02, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kappa light chain variable region, Anti-colorectal carcinoma light chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG1 anti-TS1 VL, Gm16939
    Database cross-references and differences (RAF-indexed):
    • PDB 4HDI (0-End)
    Domains in SCOPe 2.07: d4hdia1, d4hdia2
  • Chain 'B':
    Compound: Ig heavy chain V region RF, Ig gamma-3 chain C region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HDI (Start-219)
  • Chain 'H':
    Compound: Ig heavy chain V region RF, Ig gamma-3 chain C region
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HDI (0-219)
  • Chain 'L':
    Compound: Kappa light chain variable region, Anti-colorectal carcinoma light chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG1 anti-TS1 VL, Gm16939
    Database cross-references and differences (RAF-indexed):
    • PDB 4HDI (0-218)
    Domains in SCOPe 2.07: d4hdil1, d4hdil2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hdiA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvanrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hdiA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvanrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hdiL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvanrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec