PDB entry 4hdb

View 4hdb on RCSB PDB site
Description: Crystal Structure of HIV-1 protease mutants D30N complexed with inhibitor GRL-0519
Class: HYDROLASE/Hydrolase Inhibitor
Keywords: aspartic acid protease, drug resistance, HIV-1 protease inhibitor GRL-0519, HYDROLASE-Hydrolase Inhibitor complex
Deposited on 2012-10-02, released 2013-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.159
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11686]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367
    • engineered mutation (6)
    • engineered mutation (29)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d4hdba_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11686]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered mutation (6)
    • engineered mutation (29)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d4hdbb_
• Heterogens: G52, NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hdbA (A:)
  pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hdbB (B:)
  pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf