PDB entry 4hd7

View 4hd7 on RCSB PDB site
Description: Crystal Structure of Tyrosinase from Bacillus megaterium V218G mutant soaked in CuSO4
Class: oxidoreductase
Keywords: tyrosinase, type 3 copper protein, oxidoreductase
Deposited on 2012-10-02, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.257
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZB02
      • engineered mutation (217)
    Domains in SCOPe 2.07: d4hd7a_
  • Chain 'B':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZB02
      • engineered mutation (217)
    Domains in SCOPe 2.07: d4hd7b_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hd7A (A:)
    mgnkyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaah
    mssaflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnp
    ikdfivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtp
    pwdmtsqnsfrnqlegfingpqlhnrvhrwvggqmgvgptapndpvfflhhanvdriwav
    wqiihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydielrkskrsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hd7A (A:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvgptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hd7B (B:)
    mgnkyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaah
    mssaflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnp
    ikdfivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtp
    pwdmtsqnsfrnqlegfingpqlhnrvhrwvggqmgvgptapndpvfflhhanvdriwav
    wqiihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydielrkskrsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hd7B (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvgptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie