PDB entry 4hcr

View 4hcr on RCSB PDB site
Description: Crystal structure of human MAdCAM-1 D1D2 complexed with Fab PF-547659
Class: immune system
Keywords: immunoglobulin superfamily, rolling and firm adhesion, integrin alpha4beta7, IMMUNE SYSTEM
Deposited on 2012-10-01, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.158
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (0-End)
      • engineered mutation (93)
    Domains in SCOPe 2.07: d4hcra1, d4hcra2
  • Chain 'B':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (0-End)
      • engineered mutation (93)
    Domains in SCOPe 2.07: d4hcrb1, d4hcrb2
  • Chain 'H':
    Compound: PF-547659 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HCR (0-End)
  • Chain 'L':
    Compound: PF-547659 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HCR (0-217)
    Domains in SCOPe 2.07: d4hcrl1, d4hcrl2
  • Chain 'M':
    Compound: PF-547659 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HCR (0-End)
  • Chain 'N':
    Compound: PF-547659 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HCR (0-217)
    Domains in SCOPe 2.07: d4hcrn1, d4hcrn2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hcrA (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpvppal
    ycqatmrlpglelshrqaipvlhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcrA (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeedvlfrvterwrlpplgtpvppalycqatmrl
    pglelshrqaipvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hcrB (B:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpvppal
    ycqatmrlpglelshrqaipvlhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcrB (B:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeedvlfrvterwrlpplgtpvppalycqatmrl
    pglelshrqaipvl
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hcrL (L:)
    divmtqtplslsvtpgqpasisckssqsllhtdgttylywylqkpgqppqlliyevsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgiyycmqniqlpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcrL (L:)
    divmtqtplslsvtpgqpasisckssqsllhtdgttylywylqkpgqppqlliyevsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgiyycmqniqlpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4hcrN (N:)
    divmtqtplslsvtpgqpasisckssqsllhtdgttylywylqkpgqppqlliyevsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgiyycmqniqlpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcrN (N:)
    divmtqtplslsvtpgqpasisckssqsllhtdgttylywylqkpgqppqlliyevsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgiyycmqniqlpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge