PDB entry 4hch

View 4hch on RCSB PDB site
Description: CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-tartrate
Class: isomerase
Keywords: Enolase fold, D-GLUCARATE DEHYDRATASE, D-GLUCARATE, ISOMERASE
Deposited on 2012-09-29, released 2012-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.142
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isomerase/lactonizing enzyme
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (20-401)
      • expression tag (18-19)
    Domains in SCOPe 2.06: d4hcha1, d4hcha2, d4hcha3
  • Chain 'B':
    Compound: isomerase/lactonizing enzyme
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (20-401)
      • expression tag (18-19)
    Domains in SCOPe 2.06: d4hchb1, d4hchb2, d4hchb3
  • Heterogens: TLA, GOL, MG, NA, PGE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hchA (A:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hchA (A:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hchB (B:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hchB (B:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr