PDB entry 4hcd

View 4hcd on RCSB PDB site
Description: Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
Class: isomerase
Keywords: Enolase fold, D-GLUCARATE DEHYDRATASE, D-GLUCARATE, ISOMERASE
Deposited on 2012-09-29, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.155
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isomerase/lactonizing enzyme
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu3453
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CSI0 (21-401)
      • expression tag (18-20)
    Domains in SCOPe 2.07: d4hcda1, d4hcda2, d4hcda3
  • Heterogens: CL, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hcdA (A:)
    mgsshhhhhhssglvprgshmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltv
    rtedgqeghsftapeivrphviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrt
    lavvdcalwdlagrslgqpvykliggyrdkvlaygsimcgdelegglatpedygrfaetl
    vkrgykgiklhtwmppvswapdvkmdlkacaavreavgpdirlmidafhwysrtdalalg
    rgleklgfdwieepmdeqslssykwlsdnldipvvgpesaagkhwhraewikagacdilr
    tgvndvggitpalktmhlaeafgmecevhgntamnlhvvaatkncrwyergllhpfleyd
    dghdylkslsdpmdrdgfvhvpdrpglgedidftfidnnrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcdA (A:)
    shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
    phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
    pvykliggyrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvs
    wapdvkmdlkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeq
    slssykwlsdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhl
    aeafgmecevhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgf
    vhvpdrpglgedidftfidnnrvr