PDB entry 4hc1

View 4hc1 on RCSB PDB site
Description: Crystal structure of a loop deleted mutant of human MAdCAM-1 D1D2 complexed with Fab 10G3
Class: immune system
Keywords: immunoglobulin superfamily, rolling and firm adhesion, integrin alpha4beta7, IMMUNE SYSTEM
Deposited on 2012-09-28, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.203
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (Start-197)
      • engineered mutation (93)
      • engineered mutation (147)
      • insertion (149-152)
      • expression tag (198-205)
    Domains in SCOPe 2.07: d4hc1a1, d4hc1a2, d4hc1a3
  • Chain 'B':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (Start-197)
      • engineered mutation (93)
      • engineered mutation (147)
      • insertion (149-152)
      • expression tag (198-205)
    Domains in SCOPe 2.07: d4hc1b1, d4hc1b2, d4hc1b3
  • Chain 'H':
    Compound: 10G3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HC1 (0-219)
  • Chain 'L':
    Compound: 10G3 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HC1 (0-End)
    Domains in SCOPe 2.07: d4hc1l1, d4hc1l2
  • Chain 'M':
    Compound: 10G3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HC1 (0-219)
  • Chain 'N':
    Compound: 10G3 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HC1 (0-End)
    Domains in SCOPe 2.07: d4hc1n1, d4hc1n2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hc1A (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqa
    tmrlpglelshrqaipvlggenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hc1A (A:)
    pepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvrnaslsaag
    trvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpvdpnalsfs
    llvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqatmrlpgle
    lshrqaipvlggenlyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hc1B (B:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqa
    tmrlpglelshrqaipvlggenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hc1B (B:)
    pepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvrnaslsaag
    trvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpvdpnalsfs
    llvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqatmrlpgle
    lshrqaipvlggenlyfq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hc1L (L:)
    dilmtqspssmsvslgdtvsftchasqgigrnigwlqqkpgksfkgliyhgtnlkdgvps
    rfsgsgsgadysltisriesedfadyyciqyvqfpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hc1L (L:)
    dilmtqspssmsvslgdtvsftchasqgigrnigwlqqkpgksfkgliyhgtnlkdgvps
    rfsgsgsgadysltisriesedfadyyciqyvqfpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4hc1N (N:)
    dilmtqspssmsvslgdtvsftchasqgigrnigwlqqkpgksfkgliyhgtnlkdgvps
    rfsgsgsgadysltisriesedfadyyciqyvqfpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hc1N (N:)
    dilmtqspssmsvslgdtvsftchasqgigrnigwlqqkpgksfkgliyhgtnlkdgvps
    rfsgsgsgadysltisriesedfadyyciqyvqfpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne