PDB entry 4hbl

View 4hbl on RCSB PDB site
Description: Crystal structure of AbfR of Staphylococcus epidermidis
Class: transcription
Keywords: HTH, Transcription factor, DNA binding, TRANSCRIPTION
Deposited on 2012-09-28, released 2013-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, MarR family
    Species: Staphylococcus epidermidis [TaxId:176279]
    Gene: SERP2196
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HKZ1 (3-End)
      • expression tag (1-2)
      • engineered mutation (46)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d4hbla1, d4hbla2
  • Chain 'B':
    Compound: transcriptional regulator, MarR family
    Species: Staphylococcus epidermidis [TaxId:176279]
    Gene: SERP2196
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HKZ1 (3-End)
      • expression tag (1-2)
      • engineered mutation (46)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d4hblb1, d4hblb2
  • Chain 'C':
    Compound: transcriptional regulator, MarR family
    Species: Staphylococcus epidermidis [TaxId:176279]
    Gene: SERP2196
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HKZ1 (3-End)
      • expression tag (1-2)
      • engineered mutation (46)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d4hblc1, d4hblc2
  • Chain 'D':
    Compound: transcriptional regulator, MarR family
    Species: Staphylococcus epidermidis [TaxId:176279]
    Gene: SERP2196
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HKZ1 (3-148)
      • expression tag (2)
      • engineered mutation (46)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d4hbld1, d4hbld2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hblA (A:)
    snamkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlns
    igrhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscl
    pqefdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hblA (A:)
    namkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsi
    grhldlssntltpmlkrleqsgwvkrliitltdngqqqqeavfeaissclpqefdtteyd
    etkyvfeeleqtlkhlie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hblB (B:)
    snamkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlns
    igrhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscl
    pqefdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hblB (B:)
    namkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsi
    grhldlssntltpmlkrleqsgwvkrerqqliitltdngqqqqeavfeaissclpqefdt
    teydetkyvfeeleqtlkhli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hblC (C:)
    snamkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlns
    igrhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscl
    pqefdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hblC (C:)
    namkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsi
    grhldlssntltpmlkrleqsgwvkrerqqliitltdngqqqqeavfeaissclpqefdt
    teydetkyvfeeleqtlkhlie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hblD (D:)
    snamkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlns
    igrhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscl
    pqefdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hblD (D:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek