PDB entry 4h9g

View 4h9g on RCSB PDB site
Description: Probing EF-Tu with a very small brominated fragment library identifies the CCA pocket
Class: translation
Keywords: P-loop, GTPase, GTP Binding, tRNA Binding, Ribosome Binding, TRANSLATION
Deposited on 2012-09-24, released 2013-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu-a
    Species: Thermus thermophilus [TaxId:274]
    Gene: tuf, tufA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-404)
      • conflict (263)
    Domains in SCOPe 2.05: d4h9ga1, d4h9ga2, d4h9ga3
  • Heterogens: GNP, MG, NH4, SO4, 14J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h9gA (A:)
    akgefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h9gA (A:)
    kgefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargi
    tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil
    larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq
    mhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgr
    iergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreeverg
    qvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvem
    vmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile