PDB entry 4h83

View 4h83 on RCSB PDB site
Description: Crystal structure of Mandelate racemase/muconate lactonizing enzyme (EFI target:502127)
Class: isomerase
Keywords: Structural Genomics, Enzyme Function Initiative, Tim Barrel, racemase/enolase, ISOMERASE
Deposited on 2012-09-21, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.15
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h83a1, d4h83a2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h83b1, d4h83b2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h83c1, d4h83c2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h83d1, d4h83d2
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h83e1, d4h83e2
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4h83f1, d4h83f2
  • Heterogens: NA, BCT, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h83A (A:)
    mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdag
    iigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglv
    alaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqelgl
    agvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnirwf
    eepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggpta
    wlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnn
    gtltlsdrpglgwdlnwdyidqyrvskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h83A (A:)
    ltitrietipmvaplmthrativtrvhtdagiigeaytgdehetmfdidriiheelaptl
    igqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyr
    nelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagdd
    fiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqt
    efsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthlla
    sqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h83B (B:)
    mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdag
    iigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglv
    alaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqelgl
    agvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnirwf
    eepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggpta
    wlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnn
    gtltlsdrpglgwdlnwdyidqyrvskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h83B (B:)
    gltitrietipmvaplrativtrvhtdagiigeaytgdehetmfdidriiheelaptlig
    qdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrne
    lpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfi
    icidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtef
    sasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasq
    phgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h83C (C:)
    mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdag
    iigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglv
    alaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqelgl
    agvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnirwf
    eepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggpta
    wlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnn
    gtltlsdrpglgwdlnwdyidqyrvskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h83C (C:)
    gltitrietipmvaplhrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
    gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrn
    elpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddf
    iicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqte
    fsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllas
    qphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h83D (D:)
    mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdag
    iigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglv
    alaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqelgl
    agvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnirwf
    eepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggpta
    wlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnn
    gtltlsdrpglgwdlnwdyidqyrvskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h83D (D:)
    ltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidr
    iiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkm
    plwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaari
    taareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryq
    gsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghhe
    epqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdy
    idqyrv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4h83E (E:)
    mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdag
    iigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglv
    alaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqelgl
    agvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnirwf
    eepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggpta
    wlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnn
    gtltlsdrpglgwdlnwdyidqyrvskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h83E (E:)
    gltitrietipmvaplrativtrvhtdagiigeaytgdehetmfdidriiheelaptlig
    qdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrne
    lpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfi
    icidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtef
    sasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasq
    phgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4h83F (F:)
    mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdag
    iigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglv
    alaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqelgl
    agvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnirwf
    eepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggpta
    wlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnn
    gtltlsdrpglgwdlnwdyidqyrvskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h83F (F:)
    gltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdid
    riiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalk
    mplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaar
    itaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvry
    qgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghh
    eepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwd
    yidqyrvs