PDB entry 4h73

View 4h73 on RCSB PDB site
Description: Thermostable aldehyde dehydrogenase from Pyrobaculum sp. complexed with NADP+
Class: oxidoreductase
Keywords: Fold, protein, aldehyde oxidation, NADP reduction, Intracellular, cytoplasmic, OXIDOREDUCTASE
Deposited on 2012-09-20, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73d_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73e_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73f_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73g_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h73h_
  • Heterogens: NDP, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h73A (A:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73A (A:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    al
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h73B (B:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73B (B:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h73C (C:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73C (C:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h73D (D:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73D (D:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4h73E (E:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73E (E:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4h73F (F:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73F (F:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4h73G (G:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73G (G:)
    kvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipa
    irraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgr
    vlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtg
    wliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtl
    ktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfiery
    vhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepa
    ifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriae
    avesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpip
    salk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4h73H (H:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h73H (H:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk