PDB entry 4h6k

View 4h6k on RCSB PDB site
Description: W116I mutant of OYE1
Class: oxidoreductase
Keywords: carvone, enantioselectivity, flipped binding mode, enoate reductase, biocatalysis, alkene reductase, semi rational design, tim barrel, alpha/beta barrel, OXIDOREDUCTASE
Deposited on 2012-09-19, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.184
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph dehydrogenase 1
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: OYE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02899 (0-398)
      • engineered mutation (115)
    Domains in SCOPe 2.07: d4h6ka_
  • Heterogens: FMN, CL, MG, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h6kA (A:)
    sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
    aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlivlgw
    aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
    iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
    glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
    egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
    ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk