PDB entry 4h60

View 4h60 on RCSB PDB site
Description: High resolution structure of Vibrio cholerae chemotaxis protein CheY4 crystallized in low pH (4.0) condition
Class: signaling protein
Keywords: Rossmann Fold, response regulator, chemotaxis, SIGNALING PROTEIN
Deposited on 2012-09-19, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.218
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Vibrio cholerae [TaxId:345073]
    Gene: cheY-4
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3M734 (1-119)
      • expression tag (0)
    Domains in SCOPe 2.06: d4h60a1, d4h60a2
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h60A (A:)
    amakvlavddsisirqmvshtlqdagyevetaadgrealakaqkarfdviisdvnmpvmt
    gfefvkavrmqsqykftpilmlttetspekkqegkavgatgwlvkpfnpetllktlqrvl