PDB entry 4h52

View 4h52 on RCSB PDB site
Description: Wild-type influenza N2 neuraminidase covalent complex with 3-fluoro-Neu5Ac
Class: hydrolase/hydrolase inhibitor
Keywords: NEURAMINIDASE, INFLUENZA SURFACE GLYCOPROTEIN, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-09-18, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.152
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:382827]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h52a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:382827]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h52b_
  • Heterogens: CA, FSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h52A (A:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
    gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h52B (B:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
    gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi