PDB entry 4h4i

View 4h4i on RCSB PDB site
Description: OYE1-W116V complexed with the dismutation product of (S)-carvone
Class: oxidoreductase
Keywords: carvone, dismutation, enantioselectivity, enantiocomplementary, flipped binding, alpha/beta barrel, TIM barrel, nad(P)h oxidoreductase, NAD(P)H, FMN, OXIDOREDUCTASE
Deposited on 2012-09-17, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.126
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph dehydrogenase 1
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: OYE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02899 (Start-399)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d4h4ia_
  • Heterogens: MG, 0WV, NA, 1PE, FMN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h4iA (A:)
    msfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytq
    raqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlvvlg
    waafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakn
    siaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighek
    vglrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflte
    gegeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdr
    lekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h4iA (A:)
    sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
    aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlvvlgw
    aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
    iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
    glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
    egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
    ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk