PDB entry 4h3e

View 4h3e on RCSB PDB site
Description: Crystal structure of a putative iron superoxide dismutase from Trypanosoma cruzi bound to iron
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, radical oxygen species, trypanosomiasis, parasitic euglenoid trypanosome, Chagas Disease, radical scavenger, hydrogen peroxide, antioxidant, OXIDOREDUCTASE
Deposited on 2012-09-13, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: Tc00.1047053509775.40
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DCQ3 (Start-240)
      • see remark 999 (135)
    Domains in SCOPe 2.07: d4h3ea1, d4h3ea2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: Tc00.1047053509775.40
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DCQ3 (Start-240)
      • see remark 999 (135)
    Domains in SCOPe 2.07: d4h3eb1, d4h3eb2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h3eA (A:)
    mahhhhhhmlrravnisiargrmalmsyatlpdllkpsgapaelpklgfnwkdgcapvfs
    prqmelhytkhhkayvdklnalagttydgksieeiilavandaekkglfnqaaqhfnhtf
    yfrcitpngkampksfesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlv
    idntsnagcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqai
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h3eA (A:)
    yatlpdllkpsgapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagtty
    dgksieeiilavandaekkglfnqaaqhfnhtfyfrcitpngkampksfesavtaqfgsv
    eqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsnagcpltkglrpvlavdvweha
    yykdfenrrpdylkeiwsvidwefvakmhaqaik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h3eB (B:)
    mahhhhhhmlrravnisiargrmalmsyatlpdllkpsgapaelpklgfnwkdgcapvfs
    prqmelhytkhhkayvdklnalagttydgksieeiilavandaekkglfnqaaqhfnhtf
    yfrcitpngkampksfesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlv
    idntsnagcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqai
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h3eB (B:)
    yatlpdllkpsgapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagtty
    dgksieeiilavandaekkglfnqaaqhfnhtfyfrcitpngkampksfesavtaqfgsv
    eqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsnagcpltkglrpvlavdvweha
    yykdfenrrpdylkeiwsvidwefvakmhaqaik