PDB entry 4h27

View 4h27 on RCSB PDB site
Description: Modulating the function of human serine racemase and human serine dehydratase by protein engineering
Class: lyase
Keywords: PLP dependent typeII, dehydratase, PLP binding, liver, LYASE
Deposited on 2012-09-12, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.146
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-serine dehydratase/L-threonine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: SDS, SDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20132
      • engineered mutation (100)
      • see remark 999 (124)
    Domains in SCOPe 2.07: d4h27a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h27A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmmsgeplhvktpirdsmalskmag
    tsvylkmdsaqpsgsfkirgighfckrwakqgcahfvcsssgnagmaaayaarqlgvpat
    ivvpgttpaltierlknegatvkvvgelldeafelakalaknnpgwvyippfddpliweg
    hasivkelketlwekpgaialsvggggllcgvvqglqevgwgdvpviametfgahsfhaa
    ttagklvslpkitsvakalgvktvgaqalklfqehpifsevisdqeavaaiekfvddeki
    lvepacgaalaavyshviqklqlegnlrtplpslvvivcggsnislaqlralkeqlgmtn
    rlpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h27A (A:)
    eplhvktpirdsmalskmagtsvylkmdsaqpsgsfkirgighfckrwakqgcahfvcss
    sgnagmaaayaarqlgvpativvpgttpaltierlknegatvkvvgelldeafelakala
    knnpgwvyippfddpliweghasivkelketlwekpgaialsvggggllcgvvqglqevg
    wgdvpviametfgahsfhaattagklvslpkitsvakalgvktvgaqalklfqehpifse
    visdqeavaaiekfvddekilvepacgaalaavyshviqklqlegnlrtplpslvvivcg
    gsnislaqlralkeqlgm