PDB entry 4h20

View 4h20 on RCSB PDB site
Description: Crystal Structure and Computational Modeling of the Fab Fragment from the Protective anti-Ricin Monoclonal Antibody RAC18
Class: immune system
Keywords: Ig, Anti Ricin Antibody Fab fragment, Ricin A chain, extracellular, bloodstream, IMMUNE SYSTEM
Deposited on 2012-09-11, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of Fab Fragment from the anti-Ricin Monoclonal Antibody RAC18
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4H20 (0-219)
  • Chain 'L':
    Compound: Light chain of Fab Fragment from the anti-Ricin Monoclonal Antibody RAC18
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4H20 (0-213)
    Domains in SCOPe 2.06: d4h20l1, d4h20l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h20L (L:)
    divmtqshkfmstsvgdrvsitckasqdvtsavawfqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec