PDB entry 4h1o

View 4h1o on RCSB PDB site
Description: Crystal structure of the tyrosine phosphatase SHP-2 with D61G mutation
Class: hydrolase
Keywords: alpha/beta proteins, SH2 domain, phosphatase domain, Tyrosine Phosphatase SHP-2, HYDROLASE
Deposited on 2012-09-11, released 2013-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (81)
    Domains in SCOPe 2.05: d4h1oa1, d4h1oa2, d4h1oa3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h1oA (A:)
    mgsshhhhhhssgrenlyfqgmtsrrwfhpnitgveaenllltrgvdgsflarpsksnpg
    dftlsvrrngavthikiqntggyydlyggekfatlaelvqyymehhgqlkekngdvielk
    yplncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkge
    sndgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplntt
    rinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknry
    knilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntvn
    dfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlr
    elklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhc
    sagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavq
    hyietlqrrieeeqkskrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h1oA (A:)
    tsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgg
    yydlyggekfatlaelvqyymehhgqlkdvielkyplncadptserwfhghlsgkeaekl
    ltekgkhgsflvresqshpgdfvlsvrtsndgkskvthvmircqelkydvgggerfdslt
    dlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeck
    llysrkegqrqenknknryknilpfdhtrvvlhdsdyinaniimpefkksyiatqgclqn
    tvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdy
    tlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvv
    vhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiym
    avqhyietlqrrieee