PDB entry 4h0m

View 4h0m on RCSB PDB site
Description: X-Ray Crystal Structure of Phycocyanin from Synechococcus elongatus sp. PCC 7942
Class: photosynthesis
Keywords: Component of the phycobilisome, photosynthetic antenna complex, PHOTOSYNTHESIS
Deposited on 2012-09-09, released 2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.242
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0ma_
  • Chain 'B':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mb_
  • Chain 'C':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mc_
  • Chain 'D':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0md_
  • Chain 'E':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0me_
  • Chain 'F':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mf_
  • Chain 'G':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mg_
  • Chain 'H':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mh_
  • Chain 'I':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mi_
  • Chain 'J':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mj_
  • Chain 'K':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mk_
  • Chain 'L':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0ml_
  • Chain 'M':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mm_
  • Chain 'N':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mn_
  • Chain 'O':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mo_
  • Chain 'P':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mp_
  • Chain 'Q':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mq_
  • Chain 'R':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mr_
  • Chain 'S':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0ms_
  • Chain 'T':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mt_
  • Chain 'U':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mu_
  • Chain 'V':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mv_
  • Chain 'W':
    Compound: C-phycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mw_
  • Chain 'X':
    Compound: C-phycocyanin beta chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h0mx_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h0mA (A:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mA (A:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h0mB (B:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mB (B:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h0mC (C:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mC (C:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h0mD (D:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mD (D:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4h0mE (E:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mE (E:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4h0mF (F:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mF (F:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4h0mG (G:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mG (G:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4h0mH (H:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mH (H:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4h0mI (I:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mI (I:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4h0mJ (J:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mJ (J:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4h0mK (K:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mK (K:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4h0mL (L:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mL (L:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4h0mM (M:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mM (M:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4h0mN (N:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mN (N:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4h0mO (O:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mO (O:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4h0mP (P:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mP (P:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4h0mQ (Q:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mQ (Q:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4h0mR (R:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mR (R:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4h0mS (S:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mS (S:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4h0mT (T:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mT (T:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4h0mU (U:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mU (U:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4h0mV (V:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mV (V:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4h0mW (W:)
    msktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanav
    yskfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldein
    ktfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mW (W:)
    sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
    skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
    tfdlapswyvealkyikanhglsgdsrdeansyidylinals
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4h0mX (X:)
    mtfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaral
    faeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretyla
    lgvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0mX (X:)
    tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
    aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
    gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava