PDB entry 4h0i

View 4h0i on RCSB PDB site
Description: Crystal Structure of Scfv-2D10 in Complex with Methyl Alpha-D-Mannopyranoside
Class: immune system
Keywords: single chain antibody, molecular mimicry, antigen recognition, IMMUNE SYSTEM
Deposited on 2012-09-08, released 2013-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2D10 scFv
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4H0I (0-250)
    Domains in SCOPe 2.06: d4h0ia1, d4h0ia2
  • Heterogens: MMA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h0iA (A:)
    meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts
    ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss
    akttggggsggggsggggsdvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwy
    lqkpgqspklliykvsnrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpy
    tfgggtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0iA (A:)
    meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts
    ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss
    akttgsdvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliy
    kvsnrfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpytfgggtkleik