PDB entry 4h0c

View 4h0c on RCSB PDB site
Description: Crystal structure of phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053
Class: hydrolase
Keywords: PSI-BIOLOGY, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, phospholipase/Carboxylesterase, HYDROLASE
Deposited on 2012-09-07, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.139
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase/Carboxylesterase
    Species: Dyadobacter fermentans [TaxId:471854]
    Gene: Dfer_0355
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6VYE5 (3-209)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d4h0ca_
  • Chain 'B':
    Compound: Phospholipase/Carboxylesterase
    Species: Dyadobacter fermentans [TaxId:471854]
    Gene: Dfer_0355
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6VYE5 (3-209)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d4h0cb_
  • Heterogens: CIT, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h0cA (A:)
    snamythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnn
    swypysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttr
    narkyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledm
    naavsqvvypgrphtisgdeiqlvnntilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h0cB (B:)
    snamythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnn
    swypysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttr
    narkyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledm
    naavsqvvypgrphtisgdeiqlvnntilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h0cB (B:)
    namythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnns
    wypysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttrn
    arkyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledmn
    aavsqvvypgrphtisgdeiqlvnntilk