PDB entry 4gzx

View 4gzx on RCSB PDB site
Description: N2 neuraminidase D151G mutant of A/Tanzania/205/2010 H3N2 in complex with human sialic acid receptor
Class: viral protein
Keywords: beta-propeller, influenza virus, neuraminidase, hemagglutinin, hemadsorption, viral infection, sialic acid receptor, viral protein
Deposited on 2012-09-06, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:119210]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GZX (Start-392)
    Domains in SCOPe 2.07: d4gzxa_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:119210]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GZX (Start-392)
    Domains in SCOPe 2.07: d4gzxb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:119210]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GZX (Start-392)
    Domains in SCOPe 2.07: d4gzxc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:119210]
    Database cross-references and differences (RAF-indexed):
    • PDB 4GZX (Start-392)
    Domains in SCOPe 2.07: d4gzxd_
  • Heterogens: NAG, CA, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gzxA (A:)
    gspsraeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgq
    gttlnnvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitg
    ddknatasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilf
    ieegkivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssy
    vcsglvgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyet
    fkviegwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetev
    lwtsnsivvfcgtsgtygtgswpdgadlnlmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzxA (A:)
    aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln
    nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna
    tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk
    ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl
    vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie
    gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn
    sivvfcgtsgtygtgswpdgadlnlmpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gzxB (B:)
    gspsraeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgq
    gttlnnvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitg
    ddknatasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilf
    ieegkivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssy
    vcsglvgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyet
    fkviegwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetev
    lwtsnsivvfcgtsgtygtgswpdgadlnlmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzxB (B:)
    aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln
    nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna
    tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk
    ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl
    vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie
    gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn
    sivvfcgtsgtygtgswpdgadlnlmpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gzxC (C:)
    gspsraeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgq
    gttlnnvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitg
    ddknatasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilf
    ieegkivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssy
    vcsglvgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyet
    fkviegwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetev
    lwtsnsivvfcgtsgtygtgswpdgadlnlmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzxC (C:)
    aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln
    nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna
    tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk
    ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl
    vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie
    gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn
    sivvfcgtsgtygtgswpdgadlnlmpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gzxD (D:)
    gspsraeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgq
    gttlnnvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitg
    ddknatasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilf
    ieegkivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssy
    vcsglvgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyet
    fkviegwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetev
    lwtsnsivvfcgtsgtygtgswpdgadlnlmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzxD (D:)
    aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln
    nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna
    tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk
    ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl
    vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie
    gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn
    sivvfcgtsgtygtgswpdgadlnlmpi