PDB entry 4gzm

View 4gzm on RCSB PDB site
Description: Crystal structure of RAC1 F28L mutant
Class: hydrolase
Keywords: Rossmann fold, GTP binding, membrane, HYDROLASE
Deposited on 2012-09-06, released 2012-12-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.255
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (Start-203)
      • engineered mutation (54)
    Domains in SCOPe 2.04: d4gzma_
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (Start-203)
      • engineered mutation (54)
    Domains in SCOPe 2.04: d4gzmb_
  • Heterogens: GSP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gzmA (A:)
    mgsshhhhhhssglvprgshmenlyfqgqaikcvvvgdgavgktcllisyttnalpgeyi
    ptvfdnysanvmvdgkpvnlglwdtagqedydrlrplsypqtdvflicfslvspasfenv
    rakwypevrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavk
    ylecsaltqrglktvfdeairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzmA (A:)
    ikcvvvgdgavgktcllisyttnalpgeyiptvfdnysanvmvdgkpvnlglwdtagqed
    ydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddk
    dtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gzmB (B:)
    mgsshhhhhhssglvprgshmenlyfqgqaikcvvvgdgavgktcllisyttnalpgeyi
    ptvfdnysanvmvdgkpvnlglwdtagqedydrlrplsypqtdvflicfslvspasfenv
    rakwypevrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavk
    ylecsaltqrglktvfdeairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzmB (B:)
    ikcvvvgdgavgktcllisyttnalpgeyiptvfdnysanvmvdgkpvnlglwdtagqed
    ydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddk
    dtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl