PDB entry 4gzj

View 4gzj on RCSB PDB site
Description: Active-site mutant of potato endo-1,3-beta-glucanase in complex with laminaratriose and laminaratetrose
Class: Hydrolase
Keywords: glucoside hydrolase, GH17 family, pathogenesis-related class-2 protein (PR-2), carbohydrate/sugar binding, catalytic nucleophile mutation, laminaratriose, laminaratetrose, TIM Barrel, Hydrolase
Deposited on 2012-09-06, released 2013-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.151
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucan endo-1,3-beta-D-glucosidase
    Species: Solanum tuberosum [TaxId:4113]
    Gene: gluB20-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70C53 (0-314)
      • engineered mutation (235)
    Domains in SCOPe 2.06: d4gzja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gzjA (A:)
    qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
    lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
    ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
    fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsasgwp
    seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
    lfnpdqrpkyqlnfnlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gzjA (A:)
    qpigvcygkiannlpsdqdviklynannikkmriyyphtnvfnalkgsnieiildvpnqd
    lealanpsnangwvqdnirnhfpdvkfkyiavgnevdpgresgkyarfvgpameniynal
    ssaglqnqikvststysglltntypprdsifreeyksfinpiigflarhnlpllaniypy
    fghidntnavplsyalfnqqrrndtgyqnlfdalvdsmyfateklggqnieiivsasgwp
    seghpaatlknartyytnlinhvkrgagtpkkpgktietylfamfdenekkgeasekhfg
    lfnpdqrpkyqlnfn